Pou3f3 Antibody - C-terminal region : Biotin

Conjugation: Biotin

Description of Target: Pou3f3 acts as a transcriptional activator in oligodendrocytes; Pou3f3 may play a role in regulation of neural development

Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Rat Pou3f3

Molecular Weight: 54kDa

Peptide Sequence: Synthetic peptide located within the following region: VVRVWFCNRRQKEKRMTPPGIQQQTPDDVYSQVGTVSADTPPPHHGLQTS

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: POU domain, class 3, transcription factor 3

Protein Size: 497

Purification: Affinity Purified

• SKU: AVIARP57888_P050-Btn
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP57888_P050-Biotin
• Green Labware: No
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Dog (Canine)
• Clonality: Polyclonal
• Application: Western Blotting, Immunohistochemistry
• Human Gene ID: 192109
• Host: Rabbit