PPID Antibody - N-terminal region : Biotin

Conjugation: Biotin

Description of Target: PPID is a member of the peptidyl-prolyl cis-trans isomerase (PPIase) family. PPIases catalyze the cis-trans isomerization of proline imidic peptide bonds in oligopeptides and accelerate the folding of proteins. This protein has been shown to possess PPIas

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human PPID

Key Reference: Kajitani,K., (2008) Proteins 70 (4), 1635-1639

Molecular Weight: 41kDa

Peptide Sequence: Synthetic peptide located within the following region: CPFHRIIKKFMIQGGDFSNQNGTGGESIYGEKFEDENFHYKHDREGLLSM

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Peptidyl-prolyl cis-trans isomerase D

Protein Size: 370

Purification: Affinity Purified

• SKU: AVIARP56624_P050-Btn
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP56624_P050-Biotin
• Green Labware: No
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Yeast, Horse (Equine)
• Clonality: Polyclonal
• Application: Western Blotting
• Human Gene ID: 5481
• Host: Rabbit