PPIL2 Antibody - middle region : Biotin

PPIL2 Antibody - middle region : Biotin
SKU
AVIARP55025_P050-Btn
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: Biotin

Description of Target: PPIL2 is a member of the cyclophilin family of peptidylprolyl isomerases. The cyclophilins are a highly conserved ubiquitous family, members of which play an important role in protein folding, immunosuppression by cyclosporin A, and infection of HIV-1 vir

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human PPIL2

Key Reference: Pushkarsky,T., (2005) J. Biol. Chem. 280 (30), 27866-27871

Molecular Weight: 59kDa

Peptide Sequence: Synthetic peptide located within the following region: MKIIDPDEEKAKQDPSYYLKNTNAETRETLQELYKEFKGDEILAATMKAP

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Peptidyl-prolyl cis-trans isomerase-like 2

Protein Size: 520

Purification: Affinity Purified
More Information
SKU AVIARP55025_P050-Btn
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP55025_P050-Biotin
Green Labware No
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish
Clonality Polyclonal
Application Western Blotting
Human Gene ID 23759
Host Rabbit
Product information (PDF) Download
MSDS (PDF)
×