PPM1A Antibody - middle region : Biotin

Conjugation: Biotin

Description of Target: The protein encoded by this gene is a member of the PP2C family of Ser/Thr protein phosphatases. PP2C family members are known to be negative regulators of cell stress response pathways. This phosphatase dephosphorylates, and negatively regulates the acti

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human PPM1A

Key Reference: Wu,S.K., (2007) World J. Gastroenterol. 13 (34), 4554-4559

Molecular Weight: 36kDa

Peptide Sequence: Synthetic peptide located within the following region: EIDEHMRVMSEKKHGADRSGSTAVGVLISPQHTYFINCGDSRGLLCRNRK

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Protein phosphatase 1A

Protein Size: 324

Purification: Affinity Purified

• SKU: AVIARP57765_P050-Btn
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP57765_P050-Biotin
• Green Labware: No
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
• Clonality: Polyclonal
• Application: Western Blotting
• Human Gene ID: 5494
• Host: Rabbit