PPM1B Antibody - N-terminal region : HRP

Conjugation: HRP: Horseradish Peroxidase

Description of Target: The protein encoded by this gene is a member of the PP2C family of Ser/Thr protein phosphatases. PP2C family members are known to be negative regulators of cell stress response pathways. This phosphatase has been shown to dephosphorylate cyclin-dependent

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human PPM1B

Key Reference: Xiao,K., (2007) Proc. Natl. Acad. Sci. U.S.A. 104 (29), 12011-12016

Molecular Weight: 21kDa

Peptide Sequence: Synthetic peptide located within the following region: EIMEKSGEEGMPDLAHVMRILSAENIPNLPPGGGLAGKRNVIEAVYSRLN

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Protein phosphatase 1B

Protein Size: 192

Purification: Affinity Purified

• SKU: AVIARP57767_P050-HRP
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP57767_P050-HRP
• Green Labware: No
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
• Clonality: Polyclonal
• Application: Western Blotting
• Human Gene ID: 5495
• Host: Rabbit