PPOX Antibody - C-terminal region : FITC

Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: This gene encodes the penultimate enzyme of heme biosynthesis, which catalyzes the 6-electron oxidation of protoporphyrinogen IX to form protoporphyrin IX. Mutations in this gene cause variegate porphyria, an autosomal dominant disorder of heme metabolism resulting from a deficiency in protoporphyrinogen oxidase, an enzyme located on the inner mitochondrial membrane. Alternatively spliced transcript variants encoding the same protein have been identified.

Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of human PPOX

Molecular Weight: 17kDa

Peptide Sequence: Synthetic peptide located within the following region: GGALHALPTGLRGLLRPSPPFSKPLFWAGLRELTKPRGKEPDETVHSFAQ

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: protoporphyrinogen oxidase

Protein Size: 158

Purification: Affinity Purified

• SKU: AVIARP56096_P050FITC
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP56096_P050-FITC
• Green Labware: No
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
• Clonality: Polyclonal
• Application: Western Blotting
• Human Gene ID: 5498
• Host: Rabbit