PPP2R1A Antibody - middle region : HRP

Conjugation: HRP: Horseradish Peroxidase

Description of Target: PPP2R1A is a constant regulatory subunit of protein phosphatase 2. Protein phosphatase 2 is one of the four major Ser/Thr phosphatases, and it is implicated in the negative control of cell growth and division. It consists of a common heteromeric core enzy

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human PPP2R1A

Molecular Weight: 65kDa

Peptide Sequence: Synthetic peptide located within the following region: NVAKSLQKIGPILDNSTLQSEVKPILEKLTQDQDVDVKYFAQEALTVLSL

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Serine/threonine-protein phosphatase 2A 65 kDa regulatory subunit A alpha isoform

Protein Size: 589

Purification: Affinity Purified

Subunit: A alpha isoform

• SKU: AVIARP56742_P050-HRP
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP56742_P050-HRP
• Green Labware: No
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
• Clonality: Polyclonal
• Application: Western Blotting
• Human Gene ID: 5518
• Host: Rabbit