Ppp2r2a Antibody - C-terminal region : FITC

Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: Human homolog forms a complex with cyclin G2 that may inhibit cell cycle progression.

Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Rat Ppp2r2a

Molecular Weight: 49kDa

Peptide Sequence: Synthetic peptide located within the following region: ASRENNKPRTVLKPRKVCASGKRKKDEISVDSLDFNKKILHTAWHPKENI

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Serine/threonine-protein phosphatase 2A 55 kDa regulatory subunit B alpha isoform

Protein Size: 447

Purification: Affinity Purified

Subunit: B alpha isoform

• SKU: AVIARP56158_P050FITC
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP56158_P050-FITC
• Green Labware: No
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
• Clonality: Polyclonal
• Application: Western Blotting
• Human Gene ID: 117104
• Host: Rabbit