Ppp2r2a Antibody - C-terminal region : HRP

Ppp2r2a Antibody - C-terminal region : HRP
SKU
AVIARP56158_P050-HRP
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: Human homolog forms a complex with cyclin G2 that may inhibit cell cycle progression.

Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Rat Ppp2r2a

Molecular Weight: 49kDa

Peptide Sequence: Synthetic peptide located within the following region: ASRENNKPRTVLKPRKVCASGKRKKDEISVDSLDFNKKILHTAWHPKENI

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Serine/threonine-protein phosphatase 2A 55 kDa regulatory subunit B alpha isoform

Protein Size: 447

Purification: Affinity Purified

Subunit: B alpha isoform
More Information
SKU AVIARP56158_P050-HRP
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP56158_P050-HRP
Green Labware No
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 117104
Host Rabbit
Product information (PDF) Download
MSDS (PDF)
×