Ppp2r3c Antibody - N-terminal region : HRP

Conjugation: HRP: Horseradish Peroxidase

Description of Target: Ppp2r3c may regulate MCM3AP phosphorylation through phosphatase recruitment. Ppp2r3c may play a role in the activation-induced cell death of B-cells.

Molecular Weight: 49kDa

Peptide Sequence: Synthetic peptide located within the following region: RFYYRLPAEDEVLLQKLREESRAVFLQRKSRELLDNEELQNLWFLLDKHQ

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Serine/threonine-protein phosphatase 2A regulatory subunit B'' subunit gamma

Protein Size: 453

Purification: Affinity Purified

Subunit: B''

• SKU: AVIARP57063_P050-HRP
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP57063_P050-HRP
• Green Labware: No
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
• Clonality: Polyclonal
• Application: Western Blotting
• Human Gene ID: 362739
• Host: Rabbit