PPP2R5C Antibody - middle region : FITC

Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: The product of this gene belongs to the phosphatase 2A regulatory subunit B family. Protein phosphatase 2A is one of the four major Ser/Thr phosphatases, and it is implicated in the negative control of cell growth and division. It consists of a common het

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human PPP2R5C

Key Reference: Shouse,G.P., (2008) Mol. Cell. Biol. 28 (1), 448-456

Molecular Weight: 45kDa

Peptide Sequence: Synthetic peptide located within the following region: RFLESPDFQPNIAKKYIDQKFVLQLLELFDSEDPRERDFLKTTLHRIYGK

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Protein phosphatase 2, regulatory subunit B', gamma isoform EMBL AAH16183.1

Protein Size: 384

Purification: Affinity Purified

Subunit: gamma isoform

• SKU: AVIARP57771_P050FITC
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP57771_P050-FITC
• Green Labware: No
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Yeast, Horse (Equine)
• Clonality: Polyclonal
• Application: Western Blotting
• Human Gene ID: 5527
• Host: Rabbit