Ppp2r5e Antibody - N-terminal region : FITC

Ppp2r5e Antibody - N-terminal region : FITC
SKU
AVIARP56694_P050FITC
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: The B regulatory subunit might modulate substrate selectivity and catalytic activity, and also might direct the localization of the catalytic enzyme to a particular subcellular compartment. Ppp2r5e interacts with cyclin G in vitro.

Immunogen: The immunogen is a synthetic peptide corresponding to a region of Mouse

Molecular Weight: 51kDa

Peptide Sequence: Synthetic peptide located within the following region: SCNIFRTLPPSDSNEFDPEEDEPTLEASWPHLQLVYEFFIRFLESQEFQP

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Serine/threonine-protein phosphatase 2A 56 kDa regulatory subunit epsilon isoform

Protein Size: 467

Purification: Affinity Purified

Subunit: epsilon isoform
More Information
SKU AVIARP56694_P050FITC
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP56694_P050-FITC
Green Labware No
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Goat (Caprine), Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 26932
Host Rabbit
Product information (PDF) Download
MSDS (PDF)
×