PPP3R1 Antibody - N-terminal region : FITC

Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: PPP3R1 is the regulatory subunit of calcineurin, a calcium-dependent, calmodulin stimulated protein phosphatase. PPP3R1 confers calcium sensitivity.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human PPP3R1

Key Reference: Wang,Y.L., (2008) Cancer Sci. 99 (6), 1100-1108

Molecular Weight: 19kDa

Peptide Sequence: Synthetic peptide located within the following region: MGNEASYPLEMCSHFDADEIKRLGKRFKKLDLDNSGSLSVEEFMSLPELQ

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Calcineurin subunit B type 1

Protein Size: 170

Purification: Affinity Purified

Subunit: B type 1

• SKU: AVIARP56124_P050FITC
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP56124_P050-FITC
• Green Labware: No
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
• Clonality: Polyclonal
• Application: Western Blotting
• Human Gene ID: 5534
• Host: Rabbit