PPP3R1 Antibody - N-terminal region : HRP

PPP3R1 Antibody - N-terminal region : HRP
SKU
AVIARP56124_P050-HRP
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: PPP3R1 is the regulatory subunit of calcineurin, a calcium-dependent, calmodulin stimulated protein phosphatase. PPP3R1 confers calcium sensitivity.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human PPP3R1

Key Reference: Wang,Y.L., (2008) Cancer Sci. 99 (6), 1100-1108

Molecular Weight: 19kDa

Peptide Sequence: Synthetic peptide located within the following region: MGNEASYPLEMCSHFDADEIKRLGKRFKKLDLDNSGSLSVEEFMSLPELQ

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Calcineurin subunit B type 1

Protein Size: 170

Purification: Affinity Purified

Subunit: B type 1
More Information
SKU AVIARP56124_P050-HRP
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP56124_P050-HRP
Green Labware No
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 5534
Host Rabbit
Product information (PDF) Download
MSDS (PDF)
×