PPP4R3A Antibody - middle region : Biotin

Conjugation: Biotin

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human SMEK1

Molecular Weight: 94kDa

Peptide Sequence: Synthetic peptide located within the following region: YWKALEDVDYVQTFKGLKLRFEQQRERQDNPKLDSMRSILRNHRYRRDAR

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: serine/threonine-protein phosphatase 4 regulatory subunit 3A

Protein Size: 820

Purification: Affinity Purified

Subunit: 3A

• SKU: AVIARP57688_P050-Btn
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP57688_P050-Biotin
• Green Labware: No
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
• Clonality: Polyclonal
• Application: Western Blotting
• Human Gene ID: 55671
• Host: Rabbit