Ppp4r4 Antibody - C-terminal region : HRP

Conjugation: HRP: Horseradish Peroxidase

Description of Target: Ppp4r4 is a putative regulatory subunit of serine/threonine-protein phosphatase 4.

Molecular Weight: 96kDa

Peptide Sequence: Synthetic peptide located within the following region: VKKTVLELDRMEMSMDMFQKKNYEKDLLDQEKEREELLFLEMEQLEKEKH

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Serine/threonine-protein phosphatase 4 regulatory subunit 4

Protein Size: 875

Purification: Affinity Purified

Subunit: 4

• SKU: AVIARP57709_P050-HRP
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP57709_P050-HRP
• Green Labware: No
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
• Clonality: Polyclonal
• Application: Western Blotting
• Human Gene ID: 74521
• Host: Rabbit