PPP5C Antibody - N-terminal region : Biotin

Conjugation: Biotin

Description of Target: PPP5C may play a role in the regulation of RNA biogenesis and/or mitosis. In vitro, PPP5C dephosphorylates serine residues of skeletal muscle phosphorylase and histone H1.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human PPP5C

Key Reference: Golden,T., (2008) Biochim. Biophys. Acta 1782 (4), 259-270

Molecular Weight: 57kDa

Peptide Sequence: Synthetic peptide located within the following region: MAMAEGERTECAEPPRDEPPADGALKRAEELKTQANDYFKAKDYENAIKF

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Serine/threonine-protein phosphatase 5

Protein Size: 499

Purification: Affinity Purified

• SKU: AVIARP56695_P050-Btn
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP56695_P050-Biotin
• Green Labware: No
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Guinea Pig, Cow (Bovine)
• Clonality: Polyclonal
• Application: Western Blotting
• Human Gene ID: 5536
• Host: Rabbit