PRAMEF10 Antibody - middle region : HRP

Conjugation: HRP: Horseradish Peroxidase

Description of Target: PRAMEF10 belongs to the PRAME family. It contains 3 LRR (leucine-rich) repeats. The function of the PRAMEF10 protein remains unknown.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human PRAMEF10

Key Reference: Gregory,S.G., (2006) Nature 441 (7091), 315-321

Molecular Weight: 55kDa

Peptide Sequence: Synthetic peptide located within the following region: DLLRHTGGLSKLGLELYPAPLESLDYKGHVNWEILTPIRAELMRTLREVR

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: PRAME family member 10

Protein Size: 474

Purification: Affinity Purified

• SKU: AVIARP54493_P050-HRP
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP54493_P050-HRP
• Green Labware: No
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human, Rabbit
• Clonality: Polyclonal
• Application: Western Blotting
• Human Gene ID: 343071
• Host: Rabbit