Preb Antibody - N-terminal region : FITC

Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: Preb was first identified based on its probable role in the regulation of pituitary gene transcription. It binds to the prolactin gene (PRL) promoter and seems to activate transcription. Guanine nucleotide exchange factor that activates SARA2. It is also required for the formation of COPII transport vesicles from the ER.

Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of Mouse Preb

Molecular Weight: 45kDa

Peptide Sequence: Synthetic peptide located within the following region: RRRGVELYRAPFPLYALRIDPKTGLLIAAGGGGAAKTGIKNGVHFLQLEL

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Prolactin regulatory element-binding protein

Protein Size: 417

Purification: Affinity Purified

• SKU: AVIARP57930_P050FITC
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP57930_P050-FITC
• Green Labware: No
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
• Clonality: Polyclonal
• Application: Western Blotting
• Human Gene ID: 50907
• Host: Rabbit