Preb Antibody - N-terminal region : HRP

Preb Antibody - N-terminal region : HRP
SKU
AVIARP57930_P050-HRP
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: Preb was first identified based on its probable role in the regulation of pituitary gene transcription. It binds to the prolactin gene (PRL) promoter and seems to activate transcription. Guanine nucleotide exchange factor that activates SARA2. It is also required for the formation of COPII transport vesicles from the ER.

Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of Mouse Preb

Molecular Weight: 45kDa

Peptide Sequence: Synthetic peptide located within the following region: RRRGVELYRAPFPLYALRIDPKTGLLIAAGGGGAAKTGIKNGVHFLQLEL

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Prolactin regulatory element-binding protein

Protein Size: 417

Purification: Affinity Purified
More Information
SKU AVIARP57930_P050-HRP
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP57930_P050-HRP
Green Labware No
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 50907
Host Rabbit
Product information (PDF) Download
MSDS (PDF)
×