Skip to the beginning of the images gallery

PrEST Antigen ADGRA2

Name: PrEST Antigen ADGRA2
Brand: Atlas Antibodies
SKU: ATLAPrEST95572-100

adhesion G protein-coupled receptor A2

SKU

ATLAPrEST95572-100

Packaging Unit

100 µl

Manufacturer

Atlas Antibodies

Availability: loading...

Price is loading...

Product Details

More Information

GeneName: ADGRA2

Sequence: LLRLNISGNIFSSLQPGVFDELPALKVVDLGTEFLTCDCHLRWLLPWAQNRSLQLSEHTLCAYPSALHAQALGSLQEAQLCCEGALELHTHHLIPSLRQVVFQGDRLPFQCSAS

Interspecies Mouse/Rat: ENSRNOG00000012991: 89%, ENSMUSG00000031486: 89%

Entrez Gene ID: 25960

UniProt ID: Q96PE1

Buffer: PBS and 1M Urea, pH 7.4.

Ensembl Gene ID: ENSG00000020181

More Information
SKU	ATLAPrEST95572-100
Manufacturer	Atlas Antibodies
Manufacturer SKU	APrEST95572-100
Green Labware	No
Package Unit	100 µl
Quantity Unit	STK
Human Gene ID	25960
Product information (PDF)	Download
MSDS (PDF)	Download