Skip to the beginning of the images gallery

PrEST Antigen AMIGO1

Name: PrEST Antigen AMIGO1
Brand: Atlas Antibodies
SKU: ATLAPrEST95645-100

adhesion molecule with Ig like domain 1

SKU

ATLAPrEST95645-100

Packaging Unit

100 µl

Manufacturer

Atlas Antibodies

Availability: loading...

Price is loading...

Product Details

More Information

GeneName: AMIGO1

Sequence: KPSSHQGDSLSSSMLSTTPNHDPMAGGDKDDGFDRRVAFLEPAGPGQGQNGKLKPGNTLPVPEATGKGQRRMSDPESVSSV

Interspecies Mouse/Rat: ENSRNOG00000045665: 100%, ENSMUSG00000050947: 100%

Entrez Gene ID: 57463

UniProt ID: Q86WK6

Buffer: PBS and 1M Urea, pH 7.4.

Ensembl Gene ID: ENSG00000181754

More Information
SKU	ATLAPrEST95645-100
Manufacturer	Atlas Antibodies
Manufacturer SKU	APrEST95645-100
Green Labware	No
Package Unit	100 µl
Quantity Unit	STK
Human Gene ID	57463
Product information (PDF)	Download
MSDS (PDF)	Download