Skip to the beginning of the images gallery

PrEST Antigen AP1G1

Name: PrEST Antigen AP1G1
Brand: Atlas Antibodies
SKU: ATLAPrEST96153-100

adaptor related protein complex 1 subunit gamma 1

SKU

ATLAPrEST96153-100

Packaging Unit

100 µl

Manufacturer

Atlas Antibodies

Availability: loading...

Price is loading...

Product Details

More Information

GeneName: AP1G1

Sequence: VPELMEMFLPATKNLLNEKNHGVLHTSVVLLTEMCERSPDMLAHFRKNEKLVPQLVRILKNLIMSGYSPEHDVSGI

Interspecies Mouse/Rat: ENSMUSG00000031731: 100%, ENSRNOG00000025619: 51%

Entrez Gene ID: 164

UniProt ID: O43747

Buffer: PBS and 1M Urea, pH 7.4.

Ensembl Gene ID: ENSG00000166747

More Information
SKU	ATLAPrEST96153-100
Manufacturer	Atlas Antibodies
Manufacturer SKU	APrEST96153-100
Green Labware	No
Package Unit	100 µl
Quantity Unit	STK
Human Gene ID	164
Product information (PDF)	Download
MSDS (PDF)	Download