Skip to the beginning of the images gallery

PrEST Antigen ATOH1

Name: PrEST Antigen ATOH1
Brand: Atlas Antibodies
SKU: ATLAPrEST96083-100

atonal bHLH transcription factor 1

SKU

ATLAPrEST96083-100

Packaging Unit

100 µl

Manufacturer

Atlas Antibodies

Availability: loading...

Price is loading...

Product Details

More Information

GeneName: ATOH1

Sequence: WLAPTLQGICTARAAQYLLHSPELGASEAAAPRDEVDGRGELVRRSSGGASSSKSPGPVKVREQLCKLKGGVVVDELGCSRQRAPSSKQVNGV

Interspecies Mouse/Rat: ENSRNOG00000006383: 89%, ENSMUSG00000073043: 89%

Entrez Gene ID: 474

UniProt ID: Q92858

Buffer: PBS and 1M Urea, pH 7.4.

Ensembl Gene ID: ENSG00000172238

More Information
SKU	ATLAPrEST96083-100
Manufacturer	Atlas Antibodies
Manufacturer SKU	APrEST96083-100
Green Labware	No
Package Unit	100 µl
Quantity Unit	STK
Human Gene ID	474
Product information (PDF)	Download
MSDS (PDF)	Download