PrEST Antigen ATOH1

atonal bHLH transcription factor 1
SKU
ATLAPrEST96129-100
Packaging Unit
100 µl
Manufacturer
Atlas Antibodies

Availability: loading...
Price is loading...
GeneName: ATOH1

Sequence: IYINALSELLQTPSGGEQPPPPPASCKSDHHHLRTAASYEGGAGNATAAGAQQASGGSQRPTPPGSCRTRFSAPASAGGYSVQLDALHFSTFEDSALTAMMAQKNLSPSLPGSILQPVQEENSKTSPRSHRSDGEF

Interspecies Mouse/Rat: ENSMUSG00000073043: 84%, ENSRNOG00000006383: 83%

Entrez Gene ID: 474

UniProt ID: Q92858

Buffer: PBS and 1M Urea, pH 7.4.

Ensembl Gene ID: ENSG00000172238

Atlas Antibodies attaches great importance to sustainability. In the production process of their high quality antibodies, Atlas follows the highest and most rigorous ethical animal welfare standards. The products are produced within Europe, which reduces the supply chain length to a minimum and WoolCool (100% natural sheep wool) is used as an insulating material instead of Styrofoam for the transportation of refrigerated goods.

More Information
SKU ATLAPrEST96129-100
Manufacturer Atlas Antibodies
Manufacturer SKU APrEST96129-100
Package Unit 100 µl
Quantity Unit STK
Human Gene ID 474
Product information (PDF) Download
MSDS (PDF) Download