Skip to the beginning of the images gallery

PrEST Antigen C11orf16

Name: PrEST Antigen C11orf16
Brand: Atlas Antibodies
SKU: ATLAPrEST95631-100

chromosome 11 open reading frame 16

SKU

ATLAPrEST95631-100

Packaging Unit

100 µl

Manufacturer

Atlas Antibodies

Availability: loading...

Price is loading...

Product Details

More Information

GeneName: C11orf16

Sequence: WRYWKRNGPEPCPGKPGTRYSNICKEEKDHKQQRAQTVVVGTTKELVSKATHMKPPQTPPGEAEHRKRSQSLAICQWN

Interspecies Mouse/Rat: ENSRNOG00000009033: 26%, ENSMUSG00000034751: 27%

Entrez Gene ID: 56673

UniProt ID: Q9NQ32

Buffer: PBS and 1M Urea, pH 7.4.

Ensembl Gene ID: ENSG00000176029

More Information
SKU	ATLAPrEST95631-100
Manufacturer	Atlas Antibodies
Manufacturer SKU	APrEST95631-100
Green Labware	No
Package Unit	100 µl
Quantity Unit	STK
Human Gene ID	56673
Product information (PDF)	Download
MSDS (PDF)	Download