Skip to the beginning of the images gallery

PrEST Antigen C15orf40

Name: PrEST Antigen C15orf40
Brand: Atlas Antibodies
SKU: ATLAPrEST96150-100

chromosome 15 open reading frame 40

SKU

ATLAPrEST96150-100

Packaging Unit

100 µl

Manufacturer

Atlas Antibodies

Availability: loading...

Price is loading...

Product Details

More Information

GeneName: C15orf40

Sequence: MPKKAGATTKGKSQSKEPERPLPPLGPVAVDPKGCVTIAIHAKPGSKQNAVTDLTAEAV

Interspecies Mouse/Rat: ENSRNOG00000052273: 81%, ENSMUSG00000025102: 78%

Entrez Gene ID: 123207

UniProt ID: Q8WUR7

Buffer: PBS and 1M Urea, pH 7.4.

Ensembl Gene ID: ENSG00000169609

More Information
SKU	ATLAPrEST96150-100
Manufacturer	Atlas Antibodies
Manufacturer SKU	APrEST96150-100
Green Labware	No
Package Unit	100 µl
Quantity Unit	STK
Human Gene ID	123207
Product information (PDF)	Download
MSDS (PDF)	Download