PrEST Antigen C15orf40

chromosome 15 open reading frame 40

GeneName: C15orf40

Sequence: MPKKAGATTKGKSQSKEPERPLPPLGPVAVDPKGCVTIAIHAKPGSKQNAVTDLTAEAV

Interspecies Mouse/Rat: ENSRNOG00000052273: 81%, ENSMUSG00000025102: 78%

Entrez Gene ID: 123207

UniProt ID: Q8WUR7

Buffer: PBS and 1M Urea, pH 7.4.

Ensembl Gene ID: ENSG00000169609

Atlas Antibodies attaches great importance to sustainability. In the production process of their high quality antibodies, Atlas follows the highest and most rigorous ethical animal welfare standards. The products are produced within Europe, which reduces the supply chain length to a minimum and WoolCool (100% natural sheep wool) is used as an insulating material instead of Styrofoam for the transportation of refrigerated goods.

• SKU: ATLAPrEST96150-100
• Manufacturer: Atlas Antibodies
• Manufacturer SKU: APrEST96150-100
• Package Unit: 100 µl
• Quantity Unit: STK
• Human Gene ID: 123207