Skip to the beginning of the images gallery

PrEST Antigen C17orf80

Name: PrEST Antigen C17orf80
Brand: Atlas Antibodies
SKU: ATLAPrEST96078-100

chromosome 17 open reading frame 80

SKU

ATLAPrEST96078-100

Packaging Unit

100 µl

Manufacturer

Atlas Antibodies

Availability: loading...

Price is loading...

Product Details

More Information

GeneName: C17orf80

Sequence: KLVVDKPEQTVKTFPLPAVGLERAATTKADKDIKNPIQPSFKMLKNTKPMTTFQEETKAQFYASEKTSPKRELAKDLPKSGESRCNP

Interspecies Mouse/Rat: ENSRNOG00000024780: 33%, ENSMUSG00000041623: 37%

Entrez Gene ID: 55028

UniProt ID: Q9BSJ5

Buffer: PBS and 1M Urea, pH 7.4.

Ensembl Gene ID: ENSG00000141219

More Information
SKU	ATLAPrEST96078-100
Manufacturer	Atlas Antibodies
Manufacturer SKU	APrEST96078-100
Green Labware	No
Package Unit	100 µl
Quantity Unit	STK
Human Gene ID	55028
Product information (PDF)	Download
MSDS (PDF)	Download