Skip to the beginning of the images gallery

PrEST Antigen C1orf146

Name: PrEST Antigen C1orf146
Brand: Atlas Antibodies
SKU: ATLAPrEST96068-100

chromosome 1 open reading frame 146

SKU

ATLAPrEST96068-100

Packaging Unit

100 µl

Manufacturer

Atlas Antibodies

Availability: loading...

Price is loading...

Product Details

More Information

GeneName: C1orf146

Sequence: VNAINLMCTIAKTTSKPYIDSICYRMITAKAYIIEQSPVWKTLQKIKLNSDSVNP

Interspecies Mouse/Rat: ENSRNOG00000047876: 82%, ENSMUSG00000089798: 85%

Entrez Gene ID: 388649

UniProt ID: Q5VVC0

Buffer: PBS and 1M Urea, pH 7.4.

Ensembl Gene ID: ENSG00000203910

More Information
SKU	ATLAPrEST96068-100
Manufacturer	Atlas Antibodies
Manufacturer SKU	APrEST96068-100
Green Labware	No
Package Unit	100 µl
Quantity Unit	STK
Human Gene ID	388649
Product information (PDF)	Download
MSDS (PDF)	Download