Skip to the beginning of the images gallery

PrEST Antigen C4orf54

Name: PrEST Antigen C4orf54
Brand: Atlas Antibodies
SKU: ATLAPrEST96043-100

chromosome 4 open reading frame 54

SKU

ATLAPrEST96043-100

Packaging Unit

100 µl

Manufacturer

Atlas Antibodies

Availability: loading...

Price is loading...

Product Details

More Information

GeneName: C4orf54

Sequence: FNRNEWKRKSDPLPMMMDSHVLSLIASEEREGVVVADGDHDKLSKRLGEVEERGTGNKAGVVLRGAPIERLQRRNSNPS

Interspecies Mouse/Rat: ENSRNOG00000018517: 29%, ENSMUSG00000090066: 81%

Entrez Gene ID: 285556

UniProt ID: D6RIA3

Buffer: PBS and 1M Urea, pH 7.4.

Ensembl Gene ID: ENSG00000248713

More Information
SKU	ATLAPrEST96043-100
Manufacturer	Atlas Antibodies
Manufacturer SKU	APrEST96043-100
Green Labware	No
Package Unit	100 µl
Quantity Unit	STK
Human Gene ID	285556
Product information (PDF)	Download
MSDS (PDF)	Download