Skip to the beginning of the images gallery

PrEST Antigen CCN5

Name: PrEST Antigen CCN5
Brand: Atlas Antibodies
SKU: ATLAPrEST96033-100

cellular communication network factor 5

SKU

ATLAPrEST96033-100

Packaging Unit

100 µl

Manufacturer

Atlas Antibodies

Availability: loading...

Price is loading...

Product Details

More Information

GeneName: CCN5

Sequence: RVEVLGKCCPEWVCGQGGGLGTQPLPAQGPQFSGLVSSLPPGVPCPEWSTAWGPCSTTCGLGMATRVSNQNRFCRLETQRRLCLSRPCPPSRGRSPQNSA

Interspecies Mouse/Rat: ENSMUSG00000027656: 65%, ENSRNOG00000010666: 65%

Entrez Gene ID: 8839

UniProt ID: O76076

Buffer: PBS and 1M Urea, pH 7.4.

Ensembl Gene ID: ENSG00000064205

More Information
SKU	ATLAPrEST96033-100
Manufacturer	Atlas Antibodies
Manufacturer SKU	APrEST96033-100
Green Labware	No
Package Unit	100 µl
Quantity Unit	STK
Human Gene ID	8839
Product information (PDF)	Download
MSDS (PDF)	Download