Skip to the beginning of the images gallery

PrEST Antigen CCR2

Name: PrEST Antigen CCR2
Brand: Atlas Antibodies
SKU: ATLAPrEST95782-100

C-C motif chemokine receptor 2

SKU

ATLAPrEST95782-100

Packaging Unit

100 µl

Manufacturer

Atlas Antibodies

Availability: loading...

Price is loading...

Product Details

More Information

GeneName: CCR2

Sequence: FHIALGCRIAPLQKPVCGGPGVRPGKNVKVTTQGLLDGRGKGKSIGRAPEASLQDKEG

Interspecies Mouse/Rat: ENSRNOG00000000054: 30%, ENSMUSG00000025020: 28%

Entrez Gene ID: 729230

UniProt ID: P41597

Buffer: PBS and 1M Urea, pH 7.4.

Ensembl Gene ID: ENSG00000121807

More Information
SKU	ATLAPrEST95782-100
Manufacturer	Atlas Antibodies
Manufacturer SKU	APrEST95782-100
Green Labware	No
Package Unit	100 µl
Quantity Unit	STK
Human Gene ID	729230
Product information (PDF)	Download
MSDS (PDF)	Download