Skip to the beginning of the images gallery

PrEST Antigen CEMIP2

Name: PrEST Antigen CEMIP2
Brand: Atlas Antibodies
SKU: ATLAPrEST95571-100

cell migration inducing hyaluronidase 2

SKU

ATLAPrEST95571-100

Packaging Unit

100 µl

Manufacturer

Atlas Antibodies

Availability: loading...

Price is loading...

Product Details

More Information

GeneName: CEMIP2

Sequence: GDPSVISVNGTDFTFRSAGVLLLVVDPCSVPFRLTEKTVFPLADVSRIEEYLKTGIPPRSIVLLSTRGEIKQLNISHLLVPLGLAKPAHLYDKGSTIFLGFSGNFKPSWTKLFTSPAGQGLGVLEQFIPLQLDEYGCPR

Interspecies Mouse/Rat: ENSMUSG00000024754: 79%, ENSRNOG00000012782: 78%

Entrez Gene ID: 23670

UniProt ID: Q9UHN6

Buffer: PBS and 1M Urea, pH 7.4.

Ensembl Gene ID: ENSG00000135048

More Information
SKU	ATLAPrEST95571-100
Manufacturer	Atlas Antibodies
Manufacturer SKU	APrEST95571-100
Green Labware	No
Package Unit	100 µl
Quantity Unit	STK
Human Gene ID	23670
Product information (PDF)	Download
MSDS (PDF)	Download