Skip to the beginning of the images gallery

PrEST Antigen CLEC1B

Name: PrEST Antigen CLEC1B
Brand: Atlas Antibodies
SKU: ATLAPrEST95686-100

C-type lectin domain family 1 member B

SKU

ATLAPrEST95686-100

Packaging Unit

100 µl

Manufacturer

Atlas Antibodies

Availability: loading...

Price is loading...

Product Details

More Information

GeneName: CLEC1B

Sequence: WSVMQRNYLQDENENRTGTLQQLAKRFCQYVVKQSELKGTFKGHKCSPCDTNWRYYGDSCYGFFRHNLTWEESK

Interspecies Mouse/Rat: ENSMUSG00000030159: 67%, ENSRNOG00000057335: 64%

Entrez Gene ID: 51266

UniProt ID: Q9P126

Buffer: PBS and 1M Urea, pH 7.4.

Ensembl Gene ID: ENSG00000165682

More Information
SKU	ATLAPrEST95686-100
Manufacturer	Atlas Antibodies
Manufacturer SKU	APrEST95686-100
Green Labware	No
Package Unit	100 µl
Quantity Unit	STK
Human Gene ID	51266
Product information (PDF)	Download
MSDS (PDF)	Download