Skip to the beginning of the images gallery

PrEST Antigen CNOT1

Name: PrEST Antigen CNOT1
Brand: Atlas Antibodies
SKU: ATLAPrEST96041-100

CCR4-NOT transcription complex subunit 1

SKU

ATLAPrEST96041-100

Packaging Unit

100 µl

Manufacturer

Atlas Antibodies

Availability: loading...

Price is loading...

Product Details

More Information

GeneName: CNOT1

Sequence: KRDILMDRILPDSGGVAKTMMESSLADFMQEVGYGFCASIEECRNIIVQFGVREVTAAQVARVLGMMARTHSGLTDGIPLQSISAPG

Interspecies Mouse/Rat: ENSMUSG00000036550: 99%, ENSRNOG00000012271: 99%

Entrez Gene ID: 23019

UniProt ID: A5YKK6

Buffer: PBS and 1M Urea, pH 7.4.

Ensembl Gene ID: ENSG00000125107

More Information
SKU	ATLAPrEST96041-100
Manufacturer	Atlas Antibodies
Manufacturer SKU	APrEST96041-100
Green Labware	No
Package Unit	100 µl
Quantity Unit	STK
Human Gene ID	23019
Product information (PDF)	Download
MSDS (PDF)	Download