Skip to the beginning of the images gallery

PrEST Antigen CSMD3

Name: PrEST Antigen CSMD3
Brand: Atlas Antibodies
SKU: ATLAPrEST95764-100

CUB and Sushi multiple domains 3

SKU

ATLAPrEST95764-100

Packaging Unit

100 µl

Manufacturer

Atlas Antibodies

Availability: loading...

Price is loading...

Product Details

More Information

GeneName: CSMD3

Sequence: SAPYQGSSTLTHTTSTGELEEHNRTTTGAIAVASTPADVTVSSVTAVTIHRLSEEQRVQVTSLRNSGLDPNTSKDGLSPHPADTQSTRRRP

Interspecies Mouse/Rat: ENSRNOG00000002394: 30%, ENSMUSG00000022311: 82%

Entrez Gene ID: 114788

UniProt ID: Q7Z407

Buffer: PBS and 1M Urea, pH 7.4.

Ensembl Gene ID: ENSG00000164796

More Information
SKU	ATLAPrEST95764-100
Manufacturer	Atlas Antibodies
Manufacturer SKU	APrEST95764-100
Green Labware	No
Package Unit	100 µl
Quantity Unit	STK
Human Gene ID	114788
Product information (PDF)	Download
MSDS (PDF)	Download