PrEST Antigen CYLC1

cylicin 1

GeneName: CYLC1

Sequence: GAKKKIDESDGTSANSKMEGLESKRGFRMSSKKTTFNEKGEKASTGRVPPSREKPPLPACEPSLPSPKVRRLCWCKMPPPPPKPRYAP

Interspecies Mouse/Rat: ENSMUSG00000116362: 50%, ENSRNOG00000056740: 53%

Entrez Gene ID: 1538

UniProt ID: P35663

Buffer: PBS and 1M Urea, pH 7.4.

Ensembl Gene ID: ENSG00000183035

Atlas Antibodies attaches great importance to sustainability. In the production process of their high quality antibodies, Atlas follows the highest and most rigorous ethical animal welfare standards. The products are produced within Europe, which reduces the supply chain length to a minimum and WoolCool (100% natural sheep wool) is used as an insulating material instead of Styrofoam for the transportation of refrigerated goods.

• SKU: ATLAPrEST96124-100
• Manufacturer: Atlas Antibodies
• Manufacturer SKU: APrEST96124-100
• Package Unit: 100 µl
• Quantity Unit: STK
• Human Gene ID: 1538