Skip to the beginning of the images gallery

PrEST Antigen DND1

Name: PrEST Antigen DND1
Brand: Atlas Antibodies
SKU: ATLAPrEST96145-100

DND microRNA-mediated repression inhibitor 1

SKU

ATLAPrEST96145-100

Packaging Unit

100 µl

Manufacturer

Atlas Antibodies

Availability: loading...

Price is loading...

Product Details

More Information

GeneName: DND1

Sequence: MMTFSGLNRGFAYARYSSRRGAQAAIATLHNHPLRPSCPLLVCRSTEKCELSVDGLPPNLTRSALLLALQPLGPGLQE

Interspecies Mouse/Rat: ENSRNOG00000016894: 90%, ENSMUSG00000044595: 88%

Entrez Gene ID: 373863

UniProt ID: Q8IYX4

Buffer: PBS and 1M Urea, pH 7.4.

Ensembl Gene ID: ENSG00000256453

More Information
SKU	ATLAPrEST96145-100
Manufacturer	Atlas Antibodies
Manufacturer SKU	APrEST96145-100
Green Labware	No
Package Unit	100 µl
Quantity Unit	STK
Human Gene ID	373863
Product information (PDF)	Download
MSDS (PDF)	Download