Skip to the beginning of the images gallery

PrEST Antigen EIF2S2

Name: PrEST Antigen EIF2S2
Brand: Atlas Antibodies
SKU: ATLAPrEST95984-100

eukaryotic translation initiation factor 2 subunit beta

SKU

ATLAPrEST95984-100

Packaging Unit

100 µl

Manufacturer

Atlas Antibodies

Availability: loading...

Price is loading...

Product Details

More Information

GeneName: EIF2S2

Sequence: TSFVNFTDICKLLHRQPKHLLAFLLAELGTSGSIDGNNQLVIKGRFQQKQIENVLRRYIKEYVT

Interspecies Mouse/Rat: ENSMUSG00000074656: 100%, ENSRNOG00000017447: 100%

Entrez Gene ID: 8894

UniProt ID: P20042

Buffer: PBS and 1M Urea, pH 7.4.

Ensembl Gene ID: ENSG00000125977

More Information
SKU	ATLAPrEST95984-100
Manufacturer	Atlas Antibodies
Manufacturer SKU	APrEST95984-100
Green Labware	No
Package Unit	100 µl
Quantity Unit	STK
Human Gene ID	8894
Product information (PDF)	Download
MSDS (PDF)	Download