Skip to the beginning of the images gallery

PrEST Antigen EPS8

Name: PrEST Antigen EPS8
Brand: Atlas Antibodies
SKU: ATLAPrEST95811-100

epidermal growth factor receptor pathway substrate 8

SKU

ATLAPrEST95811-100

Packaging Unit

100 µl

Manufacturer

Atlas Antibodies

Availability: loading...

Price is loading...

Product Details

More Information

GeneName: EPS8

Sequence: SFGMYPSQMNGYGSSPTFSQTDREHGSKTSAKALYEQRKNYARDSVSSVSDISQYRVEHLTTFVLDRKDAMITVDDGIRKLKLLDAKGKVWTQDMILQVDDRAVSLIDLESSNELENFP

Interspecies Mouse/Rat: ENSRNOG00000007047: 92%, ENSMUSG00000015766: 90%

Entrez Gene ID: 2059

UniProt ID: Q12929

Buffer: PBS and 1M Urea, pH 7.4.

Ensembl Gene ID: ENSG00000151491

More Information
SKU	ATLAPrEST95811-100
Manufacturer	Atlas Antibodies
Manufacturer SKU	APrEST95811-100
Green Labware	No
Package Unit	100 µl
Quantity Unit	STK
Human Gene ID	2059
Product information (PDF)	Download
MSDS (PDF)	Download