Skip to the beginning of the images gallery

PrEST Antigen GRIK1

Name: PrEST Antigen GRIK1
Brand: Atlas Antibodies
SKU: ATLAPrEST95808-100

glutamate ionotropic receptor kainate type subunit 1

SKU

ATLAPrEST95808-100

Packaging Unit

100 µl

Manufacturer

Atlas Antibodies

Availability: loading...

Price is loading...

Product Details

More Information

GeneName: GRIK1

Sequence: TEKAAGEVSKHLYKVWKKIGIWNSNSGLNMTDSNKDKSSNITDSLANRTL

Interspecies Mouse/Rat: ENSMUSG00000022935: 90%, ENSRNOG00000001575: 90%

Entrez Gene ID: 2897

UniProt ID: P39086

Buffer: PBS and 1M Urea, pH 7.4.

Ensembl Gene ID: ENSG00000171189

More Information
SKU	ATLAPrEST95808-100
Manufacturer	Atlas Antibodies
Manufacturer SKU	APrEST95808-100
Green Labware	No
Package Unit	100 µl
Quantity Unit	STK
Human Gene ID	2897
Product information (PDF)	Download
MSDS (PDF)	Download