Skip to the beginning of the images gallery

PrEST Antigen HSPB9

Name: PrEST Antigen HSPB9
Brand: Atlas Antibodies
SKU: ATLAPrEST95651-100

heat shock protein family B (small) member 9

SKU

ATLAPrEST95651-100

Packaging Unit

100 µl

Manufacturer

Atlas Antibodies

Availability: loading...

Price is loading...

Product Details

More Information

GeneName: HSPB9

Sequence: TGQQQLDVRDPERVSYRMSQKVHRKMLPSNLSPTAMTCCLTPSGQLWVRGQCVALALPEAQTGPSPRLGSLGSKASNLTR

Interspecies Mouse/Rat: ENSRNOG00000036819: 48%, ENSMUSG00000017832: 55%

Entrez Gene ID: 94086

UniProt ID: Q9BQS6

Buffer: PBS and 1M Urea, pH 7.4.

Ensembl Gene ID: ENSG00000260325

More Information
SKU	ATLAPrEST95651-100
Manufacturer	Atlas Antibodies
Manufacturer SKU	APrEST95651-100
Green Labware	No
Package Unit	100 µl
Quantity Unit	STK
Human Gene ID	94086
Product information (PDF)	Download
MSDS (PDF)	Download