PrEST Antigen IL11RA

interleukin 11 receptor subunit alpha

GeneName: IL11RA

Sequence: RYLTSYRKKTVLGADSQRRSPSTGPWPCPQDPLGAARCVVHGAEFWSQYRINVTEVNPLGASTRLLDVSLQSILRPDPPQGLRVESVPGYP

Interspecies Mouse/Rat: ENSMUSG00000095623: 90%, ENSRNOG00000015068: 89%

Entrez Gene ID: 3590

UniProt ID: Q14626

Buffer: PBS and 1M Urea, pH 7.4.

Ensembl Gene ID: ENSG00000137070

Atlas Antibodies attaches great importance to sustainability. In the production process of their high quality antibodies, Atlas follows the highest and most rigorous ethical animal welfare standards. The products are produced within Europe, which reduces the supply chain length to a minimum and WoolCool (100% natural sheep wool) is used as an insulating material instead of Styrofoam for the transportation of refrigerated goods.

• SKU: ATLAPrEST96192-100
• Manufacturer: Atlas Antibodies
• Manufacturer SKU: APrEST96192-100
• Package Unit: 100 µl
• Quantity Unit: STK
• Human Gene ID: 3590