Skip to the beginning of the images gallery

PrEST Antigen ITFG2

Name: PrEST Antigen ITFG2
Brand: Atlas Antibodies
SKU: ATLAPrEST95693-100

integrin alpha FG-GAP repeat containing 2

SKU

ATLAPrEST95693-100

Packaging Unit

100 µl

Manufacturer

Atlas Antibodies

Availability: loading...

Price is loading...

Product Details

More Information

GeneName: ITFG2

Sequence: GHEEVVACAWDGQTYIIDHNRTVVRFQVDENIRAFCAGLYACKEGRNSPCLVYVTFNQKIYVYWEVQLERMESTNLVKLLETKPEYHSLLQELGVDPDDL

Interspecies Mouse/Rat: ENSMUSG00000001518: 92%, ENSRNOG00000006264: 94%

Entrez Gene ID: 55846

UniProt ID: Q969R8

Buffer: PBS and 1M Urea, pH 7.4.

Ensembl Gene ID: ENSG00000111203

More Information
SKU	ATLAPrEST95693-100
Manufacturer	Atlas Antibodies
Manufacturer SKU	APrEST95693-100
Green Labware	No
Package Unit	100 µl
Quantity Unit	STK
Human Gene ID	55846
Product information (PDF)	Download
MSDS (PDF)	Download