Skip to the beginning of the images gallery

PrEST Antigen JMJD6

Name: PrEST Antigen JMJD6
Brand: Atlas Antibodies
SKU: ATLAPrEST95756-100

jumonji domain containing 6, arginine demethylase and lysine hydroxylase

SKU

ATLAPrEST95756-100

Packaging Unit

100 µl

Manufacturer

Atlas Antibodies

Availability: loading...

Price is loading...

Product Details

More Information

GeneName: JMJD6

Sequence: MNHKSKKRIREAKRSARPELKDSLDWTRHNYYESFSLSPAAVADNVERADALQLSVEEFVERYERPYKPVVLLNA

Interspecies Mouse/Rat: ENSRNOG00000000250: 95%, ENSMUSG00000056962: 93%

Entrez Gene ID: 23210

UniProt ID: Q6NYC1

Buffer: PBS and 1M Urea, pH 7.4.

Ensembl Gene ID: ENSG00000070495

More Information
SKU	ATLAPrEST95756-100
Manufacturer	Atlas Antibodies
Manufacturer SKU	APrEST95756-100
Green Labware	No
Package Unit	100 µl
Quantity Unit	STK
Human Gene ID	23210
Product information (PDF)	Download
MSDS (PDF)	Download