Skip to the beginning of the images gallery

PrEST Antigen KCNA6

Name: PrEST Antigen KCNA6
Brand: Atlas Antibodies
SKU: ATLAPrEST95945-100

potassium voltage-gated channel subfamily A member 6

SKU

ATLAPrEST95945-100

Packaging Unit

100 µl

Manufacturer

Atlas Antibodies

Availability: loading...

Price is loading...

Product Details

More Information

GeneName: KCNA6

Sequence: EQGQYTHVTCGQPAPDLRATDNGLGKPDFPEANRERRPSYLPTPHRAYAE

Interspecies Mouse/Rat: ENSMUSG00000038077: 92%, ENSRNOG00000052486: 90%

Entrez Gene ID: 3742

UniProt ID: P17658

Buffer: PBS and 1M Urea, pH 7.4.

Ensembl Gene ID: ENSG00000151079

More Information
SKU	ATLAPrEST95945-100
Manufacturer	Atlas Antibodies
Manufacturer SKU	APrEST95945-100
Green Labware	No
Package Unit	100 µl
Quantity Unit	STK
Human Gene ID	3742
Product information (PDF)	Download
MSDS (PDF)	Download