Skip to the beginning of the images gallery

PrEST Antigen KCNG4

Name: PrEST Antigen KCNG4
Brand: Atlas Antibodies
SKU: ATLAPrEST95977-100

potassium voltage-gated channel modifier subfamily G member 4

SKU

ATLAPrEST95977-100

Packaging Unit

100 µl

Manufacturer

Atlas Antibodies

Availability: loading...

Price is loading...

Product Details

More Information

GeneName: KCNG4

Sequence: RKLLRKLEELEELAKLHREDVLRQQRETRRPASHSSRWGLCMNRLREMVENPQSGL

Interspecies Mouse/Rat: ENSRNOG00000015746: 57%, ENSMUSG00000045246: 57%

Entrez Gene ID: 93107

UniProt ID: Q8TDN1

Buffer: PBS and 1M Urea, pH 7.4.

Ensembl Gene ID: ENSG00000168418

More Information
SKU	ATLAPrEST95977-100
Manufacturer	Atlas Antibodies
Manufacturer SKU	APrEST95977-100
Green Labware	No
Package Unit	100 µl
Quantity Unit	STK
Human Gene ID	93107
Product information (PDF)	Download
MSDS (PDF)	Download