Skip to the beginning of the images gallery

PrEST Antigen KCNJ3

Name: PrEST Antigen KCNJ3
Brand: Atlas Antibodies
SKU: ATLAPrEST96120-100

potassium inwardly rectifying channel subfamily J member 3

SKU

ATLAPrEST96120-100

Packaging Unit

100 µl

Manufacturer

Atlas Antibodies

Availability: loading...

Price is loading...

Product Details

More Information

GeneName: KCNJ3

Sequence: ALRRKFGDDYQVVTTSSSGSGLQPQGPGQDPQQQLVPKKKRQRFVDKNGRCNVQHGNLGSETSR

Interspecies Mouse/Rat: ENSMUSG00000026824: 98%, ENSRNOG00000005369: 98%

Entrez Gene ID: 3760

UniProt ID: P48549

Buffer: PBS and 1M Urea, pH 7.4.

Ensembl Gene ID: ENSG00000162989

More Information
SKU	ATLAPrEST96120-100
Manufacturer	Atlas Antibodies
Manufacturer SKU	APrEST96120-100
Green Labware	No
Package Unit	100 µl
Quantity Unit	STK
Human Gene ID	3760
Product information (PDF)	Download
MSDS (PDF)	Download