PrEST Antigen KCNN4

potassium calcium-activated channel subfamily N member 4
SKU
ATLAPrEST96183-100
Packaging Unit
100 µl
Manufacturer
Atlas Antibodies

Availability: loading...
Price is loading...
GeneName: KCNN4

Sequence: LQEAWMFYKHTRRKESHAARRHQRKLLAAINAFRQVRLKHRKLREQVNSMVDISKMHMILYDLQQNLSSSHRALEKQIDTLAGKLDALTELLSTALGPRQLPEPSQQ

Interspecies Mouse/Rat: ENSMUSG00000054342: 85%, ENSRNOG00000019440: 82%

Entrez Gene ID: 3783

UniProt ID: O15554

Buffer: PBS and 1M Urea, pH 7.4.

Ensembl Gene ID: ENSG00000104783

Atlas Antibodies attaches great importance to sustainability. In the production process of their high quality antibodies, Atlas follows the highest and most rigorous ethical animal welfare standards. The products are produced within Europe, which reduces the supply chain length to a minimum and WoolCool (100% natural sheep wool) is used as an insulating material instead of Styrofoam for the transportation of refrigerated goods.

More Information
SKU ATLAPrEST96183-100
Manufacturer Atlas Antibodies
Manufacturer SKU APrEST96183-100
Package Unit 100 µl
Quantity Unit STK
Human Gene ID 3783
Product information (PDF) Download
MSDS (PDF) Download