PrEST Antigen LILRB3

leukocyte immunoglobulin like receptor B3

GeneName: LILRB3

Sequence: CHYYSSAGWSEPSDPLELVMTGFYNKPTLSALPSPVVASGGNMTLRCGSQKGYHHFVLMKEGEHQLPRTLDSQQLHSGGFQALFPVGPVTPSHRWRFTCYYYYTNTPWVWSHPSDPLEILPS

Interspecies Mouse/Rat: ENSMUSG00000070873: 55%, ENSRNOG00000058087: 57%

Entrez Gene ID: 11025

UniProt ID: O75022

Buffer: PBS and 1M Urea, pH 7.4.

Ensembl Gene ID: ENSG00000204577

Atlas Antibodies attaches great importance to sustainability. In the production process of their high quality antibodies, Atlas follows the highest and most rigorous ethical animal welfare standards. The products are produced within Europe, which reduces the supply chain length to a minimum and WoolCool (100% natural sheep wool) is used as an insulating material instead of Styrofoam for the transportation of refrigerated goods.

• SKU: ATLAPrEST96134-100
• Manufacturer: Atlas Antibodies
• Manufacturer SKU: APrEST96134-100
• Package Unit: 100 µl
• Quantity Unit: STK
• Human Gene ID: 11025